PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_16019A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 326aa    MW: 35900.4 Da    PI: 5.5991
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_16019AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.15.4e-151461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd++lv     +G  +W+ +++  g+ R++k+c++rw +yl
  Oropetium_20150105_16019A 14 KGPWTAEEDQKLVGFLLTHGHCCWRVVPKLAGLLRCGKSCRLRWTNYL 61
                               79******************************99************97 PP

2Myb_DNA-binding44.63.4e-1471153547
                                -HHHHHHHHHHHHHTTTT.........................................-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   5 TteEdellvdavkqlGgg.........................................tWktIartmgkgRtlkqcksrwqky 47 
                                + +E+ l +d+++qlG++                                         +W++Ia++++ gRt++++k++w+++
  Oropetium_20150105_16019A  71 SDDEERLVIDLHAQLGNRcrselhvfsslrsfrrtraalglteddrcpvlfapsdvllcRWSKIAARLP-GRTDNEIKNHWNTH 153
                                899******************************************************************.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-20562IPR009057Homeodomain-like
PROSITE profilePS5129419.096965IPR017930Myb domain
SMARTSM007173.0E-111363IPR001005SANT/Myb domain
SuperFamilySSF466892.54E-221465IPR009057Homeodomain-like
PfamPF002491.6E-131461IPR001005SANT/Myb domain
CDDcd001671.49E-81661No hitNo description
Gene3DG3DSA:1.10.10.602.8E-206387IPR009057Homeodomain-like
SMARTSM007171.1E-966156IPR001005SANT/Myb domain
PfamPF002493.7E-1071153IPR001005SANT/Myb domain
PROSITE profilePS5129410.152101158IPR017930Myb domain
SuperFamilySSF466892.54E-22126155IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-20130158IPR009057Homeodomain-like
CDDcd001679.17E-7130154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MGRQPCCDKV GVKKGPWTAE EDQKLVGFLL THGHCCWRVV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDDEERLVID LHAQLGNRCR SELHVFSSLR SFRRTRAALG LTEDDRCPVL  120
FAPSDVLLCR WSKIAARLPG RTDNEIKNHW NTHIRKKLLR MGIDPVTHLP LQDAPAPAVQ  180
EQEERAEPQQ FHEQQRMQND SELPPQQQQQ QQQEDEPDQP LIQPHAIPTP PAPPAASACG  240
SVSSASAGSA SVVSPSCSSS AASASAASCV DAATEWPEPM YLFGMDGIMD AGWGSLFPGD  300
GCLSLDPFVD QYPGSGFDQD NDDWI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-22141584105C-Myb DNA-Binding Domain
1mse_C2e-22141584105C-Myb DNA-Binding Domain
1gv2_A3e-22141584105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1074831e-127AK107483.1 Oryza sativa Japonica Group cDNA clone:002-129-C06, full insert sequence.
GenBankFJ9402171e-127FJ940217.1 Oryza sativa Japonica Group clone KCS132B07 Myb related transcription factor mRNA, complete cds.
GenBankJX2359281e-127JX235928.1 Oryza sativa Japonica Group Myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001281099.11e-110uncharacterized protein LOC100216895
SwissprotQ50EX66e-76ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0A9ESB71e-110A0A0A9ESB7_ARUDO; Uncharacterized protein
TrEMBLB6SGK81e-110B6SGK8_MAIZE; Odorant 1 protein
TrEMBLK4JRR31e-110K4JRR3_MAIZE; MYB-type transcription factor (Fragment)
STRINGGRMZM2G048910_P011e-110(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.11e-74myb domain protein 85